PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00001593.1.g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family EIL
Protein Properties Length: 284aa    MW: 32084 Da    PI: 4.8018
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00001593.1.g00003.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3183.22.5e-561183152324
                                     SSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTT CS
                            EIN3 152 mqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerq 230
                                     mqhc ppqrrfplekg++pPWWP+G+e wwg +g+s+++g+ppy+kphdlkkawkvs L+avikhm p+++++r+l+rq
  FANhyb_rscf00001593.1.g00003.1   1 MQHCIPPQRRFPLEKGLAPPWWPKGNEIWWGDQGVSQEHGPPPYRKPHDLKKAWKVSALAAVIKHMVPNMDRVRRLVRQ 79 
                                     8****************************************************************************** PP

                                     SSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX.XX...XXXXXXXXXXXXXXXXXXXXXXXXXX...XXXXXXXXXX. CS
                            EIN3 231 skylqdkmsakesfallsvlnqeekecatvsah.ss...slrkqspkvtlsceqkedvegkkesk..ikhvqavktta. 302
                                     sk+lqdkm+ake +++++v+nqee+++ ++s++ ++   s+  ++  ++l+ ++k+    +++      +       + 
  FANhyb_rscf00001593.1.g00003.1  80 SKSLQDKMTAKEAAIWSKVVNQEEAIL-QLSTDdKKpiiSCPVNDGTMVLHANEKRKCMFDDDDGseLDAPV-----Hv 152
                                     ***********************9966.78888443566444466666666666655543332220021111.....11 PP

                                     .........XXXXXXXXXXXXXXXXXXXXX. CS
                            EIN3 303 .........gfpvvrkrkkkpsesakvsske 324
                                               + +v+k+ + +++ + vs++ 
  FANhyb_rscf00001593.1.g00003.1 153 fpktsnsewALGFVDKKSRASHNGKNVSDTT 183
                                     1222334446777777777666666666664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1167682.48E-491106IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PfamPF048732.3E-501103No hitNo description
Gene3DG3DSA:1.10.3180.101.0E-541107IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MQHCIPPQRR FPLEKGLAPP WWPKGNEIWW GDQGVSQEHG PPPYRKPHDL KKAWKVSALA  60
AVIKHMVPNM DRVRRLVRQS KSLQDKMTAK EAAIWSKVVN QEEAILQLST DDKKPIISCP  120
VNDGTMVLHA NEKRKCMFDD DDGSELDAPV HVFPKTSNSE WALGFVDKKS RASHNGKNVS  180
DTTVRVDTSC SYDHSPIDSE FESVVDWINM ELQKASVNEA GEVVSGCPSA YWEGVMEDSA  240
LDAAFEIQRE NMDLNLYPDE GISQMNQEPT SIWDLGYDYN DANL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A9e-49110522126Protein ETHYLENE INSENSITIVE 3
4zds_B9e-49110522126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007206277.17e-92hypothetical protein PRUPE_ppa016118mg
SwissprotQ9LX168e-60EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLM5W2B27e-92M5W2B2_PRUPE; Uncharacterized protein
STRINGVIT_00s0357g00120.t015e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.15e-61EIL family protein